ADWX 1

Cat no: 167621

Supplier: United States Biological

0 reviews | Write a Review Pencil

Read More on Supplier Website

Description
Additional Information

Solubility: 2mg/ml in H2O Molecular Weight: ~4071.86 Sequence: VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK (Modifications: Disulfide bridge: 7-27, 13-32, 17-34) Biological Activity: Potent and selective KV1.3 channel blocker (IC50 values are 0.0019 and 0.65 nM for KV1.3 and KV1.1, respectively). Inhibits CD4+ CCR7- T cell activation. Ameliorates rat experimental autoimmune encephalomyelitis, in a model for multiple sclerosis. Storage and Stability: Lyophilized powder may be stored at -20 degrees C. Stable for 12 months at -20 degrees C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degrees C. Reconstituted product is stable for 6 months at -20 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Catalogue number:	167621
Size:	100ug
Form:	Supplied as a lyophilized solid.
Purity:	~100% (HPLC)
References:	1. Han et al (2008) Structural basis of a potent peptide inhibitor designed for KV1.3 channel, a therapeutic target of autoimmune disease. J.Biol.Chem. 283 19058. PMID: 18480054. 2. Li et al (2012) Selective inhibition of CCR7(-) effector memory T cell activation by a novel peptide targeting Kv1.3 channel in a rat experimental autoimmune encephalomyelitis model. J.Biol.Chem. 287 29479. PMID: 22761436.

See Full Product Listings >

ADWX 1

Cat no: 167621

Get Quote

About Biosave

Product Categories

Information


Get a Quote Direct from United States Biological




By submitting this form you agree to your details being passed to United States Biological for the purpose of generating the best quote*