Suppliers Cayman Chemical Company
Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN){4212,4211,4210} . To be used in conjunction with Cayman's 5-LO polyclonal...
Peptide sequence: human cPGE synthase amino acids 58-67 (CIDPNDSKHK){8691} . To be used in conjunction with Cayman's cPGEsynthase polyclonal antibody...
Peptide Sequence: human amino acids 59-75 (CRSDPDVERSLRAHRND){7229} . To be used in conjunction with Cayman's microsomal PGE synthase-1 polyclonal antibody...
Peptide Sequence: human IP receptor amino acids . To be used in conjunction with Cayman's IP receptor (mouse) polyclonal antibody (Item No. 160070) to block...
Peptide Sequence: human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE){8451} . To be used in conjunction with Cayman's hematopoietic type...
Peptide Sequence: human lipocalin-type PGD synthase amino acids 30-41 (VQPNFQPDKFLG){8449} . To be used in conjunction with Cayman's lipocalin-type PGD...
Peptide Sequence: murine FP receptor amino acids 2-16 (SMNSSKQPVSPAAGL){3161} . To be used in conjunction with Cayman's FP receptor polyclonal antibody...
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI){3164,3186} . To be used in conjunction with Cayman's EP4...
Peptide Sequence: human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF){3180,1900} . To be used in conjunction with Cayman's EP3 receptor...
Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL){3178} . To be used in conjunction with Cayman's EP2 receptor polyclonal...
Peptide Sequence: human EP1 receptor C-terminal amino acids 380-402 (GLTPSAWEASSLRSSRHSGLSHF){3176} . To be used in conjunction with Cayman's EP1 receptor...
Peptide Sequence: N-terminal DP1 receptor amino acids 2-21 . To be used in conjunction with Cayman's DP1 receptor polyclonal antibody (Catalog No. 101640) to...
Peptide Sequence: human monoacylglycerol lipase blocking peptide amino acids 1-14 (MPEESSPRRTPQSI) . To be used in conjunction with Cayman's monoacylglycerol...
Peptide Sequence: amino acids 221-235 (VYGGKEARTEEMKWR) . To be used in conjunction with Cayman's mPGE synthase-2 polyclonal antibody (Catalog No. 160145) to...
Antigen: hamster brain SAF . Host: mouse, clone SAF 84 . Isotype: IgG . Application(s): IHC and WB
Antigen: hamster brain SAF . Host: mouse . Isotype: IgG2b . Cross Reactivity (PrPc): (+) hamster, mouse, bovine, ovine, and human PrP . Application(s): WB
Antigen: hamster brain SAF . Host: mouse, clone SAF 83 . Isotype: IgG . Application(s): EIA, FC, and WB
Antigen: recombinant human PrP . Host: mouse, clone 8G8 . Application(s): IHC
Antigen: hamster brain SAF . Host: mouse, clone SAF 61 . Isotype: IgG . Application(s): EIA and FC
Antigen: human PrP amino acids 106-126 . Host: mouse, clone Pri 308 . Isotype: IgG . Application(s): IHC and WB
Get the Best Promotions
.gif?1376593640 "Biosave Filter")
