Suppliers Abbkine Scientific Co.Ltd.
The interleukin-2 receptor (IL-2R) is a heterotrimeric protein expressed on the surface of certain immune cells, such as lymphocytes, that binds and responds...
TNFa is synthesized as a 26 kDa, type II transmembrane protein that is 233 amino acids in length. It contains a 30 amino acid (aa) cytoplasmic domain, a 26...
GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic...
The number and diversity of subunits contained in the 20S core particle depends on the organism; the number of distinct and specialized subunits is larger in...
Senile osteoporosis (SOP), also known as degenerative osteoporosis, a special performance of biological aging in bone are the occurrence of osteoporosis type...
Carbohydrate antigen 50 (CA 50) is a tumor marker that increases in many malignancies, especially in carcinoma of the digestive tract. False-positive results...
Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists...
Tau protein is a highly soluble microtubule-associated protein (MAP). In humans, these proteins are mostly found in neurons compared to non-neuronal cells....
Tumor necrosis factor receptor superfamily, member 21 is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-?B and...
This protein is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins...
This protein is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can...
This protein is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can...
This protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and...
This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for...
Tumor necrosis factor ligand superfamily member 12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for...
Tumor necrosis factor ligand superfamily member 13 is a member of the tumor necrosis factor (TNF) ligand family. Expressed at high levels in transformed cell...
Tumor necrosis factor ligand superfamily member 14 is a protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This...
The protein encoded by TNFSF15 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in...
TNFSF9 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that...
TNIK was autophosphorylated in a manner dependent upon lys54 in the ATP-binding pocket of its kinase domain. Immunoprecipitation analysis showed that...
Get the Best Promotions
.gif?1376593640 "Biosave Filter")
