Suppliers United States Biological
Solubility: 100mM in DMSO and to 50mM in ethanol Molecular Formula: C16H28N2O4S2 Biological Activity: Positive allosteric modulator of GluR2 receptors (EC50...
CDCP1, Human, BioAssay(TM) ELISA Kit is designed for the analysis of cell culture supernates. Other sample types, such as serum and plasma, need to be...
b1,3�Linked GlcNAc residues are present in the backbone of various biologically important glycans which are involved in many essential biological functions...
Apolipoprotein A1 (ApoA1) is a 28kD glycoprotein that is the major protein component of high density lipoprotein (HDL) particles. HDL particles play a...
Solubility: 2mg/ml in H2O Molecular Weight: ~4071.86 Sequence: VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK (Modifications: Disulfide bridge: 7-27, 13-32, 17-34)...
Cellulase (Onozuka R-10) is a multi-component enzyme system derived from Trichoderma viride and contains cellulase, alpha-amylase, hemicellulase, pectinase...
Suitable for use in the enumeration of Lactobacilli from food materials. Also used for the cultivation of Aerococcus viridans, Bifidobacterium coryneforme,...
Highly selective ETB-receptor antagonist (IC50=1.2nM). Solubility: DMSO (2mg/ml), Methanol:H2O (3:1) (2mg/ml), or 0.01% NH4OH (1mg/ml) Storage and Stability:...
Anti-dsDNA IgG test is used for initial diagnosis of Systemic Lupus Erythematosus (SLE) and for diagnosis of SLE different diseases. Besides the...
Vitamin B12 plays an important role in the functioning of a healthy body. It is essential to the production of red blood cells that carry oxygen through the...
Intended Use: The Syphilis TPA-Treponema pallidum IgM ELISA kit provides materials for the qualitative and semi quantitative determination of IgM-class...
The Soluble Transferrin Receptor (sTfR) has been introduced as a promising new diagnostic tool for differentiating between iron deficiency anemia (IDA) and...
Anti-tetanus toxoid antibodies are raised in response to vaccination with tetanus toxoid protein. A patient
PTH (Parathyroid hormone, Parathormone, Parathyrin) is biosynthesized in the parathyroid gland as a pre- proparathyroid hormone, a larger molecular precursor...
The glycolytic enzyme enolase (2-phosph-D-glycerate hydrolyase) exists as several dimeric isoenzymes (aa, ab, ay and yy) composed of three distinct subunits,...
Human Beta-2 Microglobulin (B2MG) is an 11.8kD protein identical to the light chain of the HLA-A, -B, and -C antigen. B2MG is expressed on nucleated cells,...
Insulin BioAssay(TM) ELISA Kit is a solid phase enzyme-linked immunosorbant assay (ELISA). This test is designed for in vitro quantitative measurement of...
Intended Use: To quantitate total human Immunoglobulin G (IgG) Principle of the Assay: Solid phase capture sandwich ELISA assay using a microwell format....
Intended Use: To quantitate total human Immunoglobulin A (IgA) Principle of the Assay: Solid phase capture sandwich ELISA assay using a microwell format....
HIV-1 was thought to be the only cause of these syndromes until 1986, when a second type of Human Immunodeficiency Virus (HIV-2) was isolated and also...
Get the Best Promotions
.gif?1376593640 "Biosave Filter")
