ADAMTS5, Recombinant, aa832-930, GST-Tag (Aggrecanase 2 A Disintegrin And Metalloproteinase with ThromboSpondin-3 motif)

Aggrecanases are glutamyl-specific multidomain metalloproteinases of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) family. They hydrolyze aggrecan, the major proteoglycan of articular cartilage, causing osteoarthritis and other joint diseases. Recent studies using knockout mice have indicated that ADAMTS-5 (aggrecanase-2) plays an essential role in aggrecan degradation in mice.\n\nProtein Sequence: VQILATDPTKPLDVRYSFFVPKKSTPKVNSVTSHGSNKVGSHTSQPQWVT\nGPWLACSRTCDTGWHTRTVQCQDGNRKLAKGCPLSQRPSAFKQCLLKKC*\n\nLength with Tag: 332 aa with GST Tag\n\nMolecular Weight: 36.52kD\n\nApplications: \nSuitable to be used to study the degradation of extracellular matrix proteoglycans, to screen for inhibitors of proteoglycan hydrolysis and to characterize inhibitor actions. The enzyme can also serve as standard in enzymatic and immunological assays.\n\nInhibitors: \nADAMTS 5 is inhibited by tissue inhibitor of matrix metalloproteinase 3 (TIMP3) and by alpha2-macroglobulin. Enzyme activity is also suppressed by chelators of divalent cations such as EDTA and by synthetic metalloproteinase inhibitors.\n\nStorage and Stability:\nAliquot to avoid repeated freezing and thawing and freeze at -70 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 3 months.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts