logo
logo
ADAMTS5, Recombinant, aa832-930, GST-Tag (Aggrecanase 2 A Disintegrin And Metalloproteinase with ThromboSpondin-3 motif)

Cat no: A0859-61E7

ADAMTS5, Recombinant, aa832-930, GST-Tag (Aggrecanase 2 A Disintegrin And Metalloproteinase with ThromboSpondin-3 motif)

Aggrecanases are glutamyl-specific multidomain metalloproteinases of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) family. They hydrolyze aggrecan, the major proteoglycan of articular cartilage, causing osteoarthritis and other joint diseases. Recent studies using knockout mice have indicated that ADAMTS-5 (aggrecanase-2) plays an essential role in aggrecan degradation in mice.\n\nProtein Sequence: VQILATDPTKPLDVRYSFFVPKKSTPKVNSVTSHGSNKVGSHTSQPQWVT\nGPWLACSRTCDTGWHTRTVQCQDGNRKLAKGCPLSQRPSAFKQCLLKKC*\n\nLength with Tag: 332 aa with GST Tag\n\nMolecular Weight: 36.52kD\n\nApplications: \nSuitable to be used to study the degradation of extracellular matrix proteoglycans, to screen for inhibitors of proteoglycan hydrolysis and to characterize inhibitor actions. The enzyme can also serve as standard in enzymatic and immunological assays.\n\nInhibitors: \nADAMTS 5 is inhibited by tissue inhibitor of matrix metalloproteinase 3 (TIMP3) and by alpha2-macroglobulin. Enzyme activity is also suppressed by chelators of divalent cations such as EDTA and by synthetic metalloproteinase inhibitors.\n\nStorage and Stability:\nAliquot to avoid repeated freezing and thawing and freeze at -70 degrees C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Aliquots are stable for at least 3 months.

Prices direct from United States Biological

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

A0859-61E7

Size

10ug

Form

Supplied as a liquid in 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8 in the elution buffer.

Purity

Glutathione Sepharose 4 Fast Flow. 12.5% SDS-PAGE Stained with Coomassie Blue.

Read more on Supplier website
Advertisehere
BMA Biomedicals Horizontal banner
BMA Biomedicals

Latest promotion FROM:

BMA Biomedicals
View promotion

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...