Home  >  Products  >  anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2) (C-Term) antibody
anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2) (C-Term) antibody

anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2) (C-Term) antibody

Cat no: ABIN310613

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2) (C-Term) antibody: This is a rabbit polyclonal antibody against AGPAT2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310613
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Accession: O15120
Gene: 10555
Concentration: 1 mg/mL
Antigen: AGPAT2
Clonality: Polyclonal
Sequence: LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENG ATAGSGVQPA
Molecular weight: 27 kDa
Entrez gene: 10555

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave