Home  >  Products  >  anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) (N-Term) antibody
anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) (N-Term) antibody

anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) (N-Term) antibody

Cat no: ABIN405914

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) (N-Term) antibody: This is a rabbit polyclonal antibody against AGPAT5. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405914
Reactivities: Human, Rat, Bovine, Chicken/Bird, Porcine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 767778,421898,55326,100233172,530414,306582
Concentration: 1 mg/mL
Antigen: AGPAT5
Clonality: Polyclonal
Sequence: RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTGVQIL LYGDLPKNKE
Molecular weight: 42 kDa
Entrez gene: 767778,421898,55326,100233172,530414,306582

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave