Home  >  Products  >  anti-Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2) (N-Term) antibody
anti-Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2) (N-Term) antibody

anti-Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2) (N-Term) antibody

Cat no: ABIN406714

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Actin Related Protein 2/3 Complex, Subunit 2, 34kDa (ARPC2) (N-Term) antibody: This is a rabbit polyclonal antibody against ARPC2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406714
Reactivities: Human, Mouse, Rat, Bovine, Porcine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 779406,10109,100153175,540838,76709,301511
Concentration: 1 mg/mL
Antigen: ARPC2
Clonality: Polyclonal
Sequence: MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQ TFLFVVFFCL
Molecular weight: 33 kDa
Entrez gene: 779406,10109,100153175,540838,76709,301511

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave