Home  >  Products  >  anti-Activating Transcription Factor 4 (Tax-Responsive Enhancer Element B67) (ATF4) (N-Term) antibody

anti-Activating Transcription Factor 4 (Tax-Responsive Enhancer Element B67) (ATF4) (N-Term) antibody

Cat no: ABIN183436


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Activating Transcription Factor 4 (Tax-Responsive Enhancer Element B67) (ATF4) (N-Term) antibody: This is a rabbit polyclonal antibody against ATF4. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183436
Reactivities: Mouse
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Accession: Q06507
Gene: 11911
Concentration: 1 mg/mL
Antigen: ATF4
Clonality: Polyclonal
Sequence: MALFTKSSSSVAVTDKDTFELSTFLESSKAPQHDRDELPE QRSVGGGLDD
Molecular weight: 42 kDa
Entrez gene: 11911

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave