Home  >  Products  >  anti-Acyl-CoA Synthetase Long-Chain Family Member 4 (ACSL4) (N-Term) antibody

anti-Acyl-CoA Synthetase Long-Chain Family Member 4 (ACSL4) (N-Term) antibody

Cat no: ABIN503078


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Acyl-CoA Synthetase Long-Chain Family Member 4 (ACSL4) (N-Term) antibody: This is a rabbit polyclonal antibody against ACSL4. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN503078
Reactivities: Human, Mouse, Rat, Bovine, Porcine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100174803,2182,448980,536628,50790,113976
Concentration: 1 mg/mL
Antigen: ACSL4
Clonality: Polyclonal
Sequence: AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKL FDHAVSKFGK
Molecular weight: 74 kDa
Entrez gene: 100174803,2182,448980,536628,50790,113976

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave