Home  >  Products  >  anti-Adiponectin, C1Q and Collagen Domain Containing (ADIPOQ) (N-Term) antibody
anti-Adiponectin, C1Q and Collagen Domain Containing (ADIPOQ) (N-Term) antibody

anti-Adiponectin, C1Q and Collagen Domain Containing (ADIPOQ) (N-Term) antibody

Cat no: ABIN182677

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Adiponectin, C1Q and Collagen Domain Containing (ADIPOQ) (N-Term) antibody: This is a rabbit polyclonal antibody against ACDC. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN182677
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 9370,403625,11450,246253
Concentration: 1 mg/mL
Antigen: ACDC
Clonality: Polyclonal
Sequence: KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFS VGLETYVTIP
Molecular weight: 27 kDa
Entrez gene: 9370,403625,11450,246253

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave