Home  >  Products  >  anti-Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2) (N-Term) antibody

anti-Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2) (N-Term) antibody

Cat no: ABIN184013


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2) (N-Term) antibody: This is a rabbit polyclonal antibody against APOBEC2. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN184013
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 10930,481788,509619,11811,301226
Concentration: 1 mg/mL
Antigen: APOBEC2
Clonality: Polyclonal
Sequence: VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLP ANFFKFQFRN
Molecular weight: 25 kDa
Entrez gene: 10930,481788,509619,11811,301226

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave