Home  >  Products  >  anti-Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide-Like 3B (APOBEC3B) (N-Term) antibody

anti-Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide-Like 3B (APOBEC3B) (N-Term) antibody

Cat no: ABIN310774


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide-Like 3B (APOBEC3B) (N-Term) antibody: This is a rabbit polyclonal antibody against APOBEC3B. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310774
Reactivities: Human, Bovine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 9582,504505
Concentration: 1 mg/mL
Antigen: APOBEC3B
Clonality: Polyclonal
Sequence: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLT ISAARLYYYW
Molecular weight: 46 kDa
Entrez gene: 9582,504505

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave