Home  >  Products  >  anti-Apoptosis-Inducing Factor, Mitochondrion-Associated, 2 (AIFM2) (Middle Region) antibody

anti-Apoptosis-Inducing Factor, Mitochondrion-Associated, 2 (AIFM2) (Middle Region) antibody

Cat no: ABIN504615


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Apoptosis-Inducing Factor, Mitochondrion-Associated, 2 (AIFM2) (Middle Region) antibody: This is a rabbit polyclonal antibody against AIFM2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN504615
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 100049086,423720,84883,479236,534217,71361,361843
Concentration: 1 mg/mL
Antigen: AIFM2
Clonality: Polyclonal
Sequence: GALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVST SWKTMRQSPP
Molecular weight: 40 kDa
Entrez gene: 100049086,423720,84883,479236,534217,71361,361843

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave