Home  >  Products  >  anti-ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A) (Middle Region) antibody

anti-ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A) (Middle Region) antibody

Cat no: ABIN502587


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A) (Middle Region) antibody: This is a rabbit polyclonal antibody against ATG9A. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502587
Reactivities: Human, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 79065,478915,100155182,540482,363254
Concentration: 1 mg/mL
Antigen: ATG9A
Clonality: Polyclonal
Sequence: VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSS VWEGQLQSLV
Molecular weight: 94 kDa
Entrez gene: 79065,478915,100155182,540482,363254

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave