Home  >  Products  >  anti-ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8) (N-Term) antibody
anti-ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8) (N-Term) antibody

anti-ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8) (N-Term) antibody

Cat no: ABIN502410

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8) (N-Term) antibody: This is a rabbit polyclonal antibody against ABCC8. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502410
Reactivities: Human, Mouse, Rat, Bovine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 6833,538996,20927,25559
Concentration: 1 mg/mL
Antigen: ABCC8
Clonality: Polyclonal
Sequence: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLF ITFPILFIGW
Molecular weight: 177 kDa
Entrez gene: 6833,538996,20927,25559

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave