Home  >  Products  >  anti-ATPase, Ca++ Transporting, Plasma Membrane 4 (ATP2B4) (Middle Region) antibody

anti-ATPase, Ca++ Transporting, Plasma Membrane 4 (ATP2B4) (Middle Region) antibody

Cat no: ABIN405649


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-ATPase, Ca++ Transporting, Plasma Membrane 4 (ATP2B4) (Middle Region) antibody: This is a rabbit polyclonal antibody against ATP2B4. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405649
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Porcine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 768304,446855,419934,493,403731,733701,282146,100353865,381290,29600
Concentration: 1 mg/mL
Antigen: ATP2B4
Clonality: Polyclonal
Sequence: FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNE INSRKIHGEK
Molecular weight: 129 kDa
Entrez gene: 768304,446855,419934,493,403731,733701,282146,100353865,381290,29600

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave