Home  >  Products  >  anti-ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1) (N-Term) antibody

anti-ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1) (N-Term) antibody

Cat no: ABIN487206


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1) (N-Term) antibody: This is a rabbit polyclonal antibody against ATP6V0A1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN487206
Reactivities: Human, Mouse, Rat, Bovine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100332691,379986,395474,535,286768,11975,29757
Concentration: 1 mg/mL
Antigen: ATP6V0A1
Clonality: Polyclonal
Sequence: RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANI PIMDTGENPE
Molecular weight: 96 kDa
Entrez gene: 100332691,379986,395474,535,286768,11975,29757

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave