Home  >  Products  >  anti-beta-1,3-N-Acetylgalactosaminyltransferase 1 (Globoside Blood Group) (B3GALNT1) (Middle Region) antibody
anti-beta-1,3-N-Acetylgalactosaminyltransferase 1 (Globoside Blood Group) (B3GALNT1) (Middle Region) antibody

anti-beta-1,3-N-Acetylgalactosaminyltransferase 1 (Globoside Blood Group) (B3GALNT1) (Middle Region) antibody

Cat no: ABIN502570

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-beta-1,3-N-Acetylgalactosaminyltransferase 1 (Globoside Blood Group) (B3GALNT1) (Middle Region) antibody: This is a rabbit polyclonal antibody against B3GALNT1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502570
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: O75752
Gene: 8706
Concentration: 1 mg/mL
Antigen: B3GALNT1
Clonality: Polyclonal
Sequence: PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLF FLYRIHLDVC
Molecular weight: 39 kDa
Entrez gene: 8706

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave