Home  >  Products  >  anti-Breast Cancer 1 (BRCA1) (N-Term) antibody
anti-Breast Cancer 1 (BRCA1) (N-Term) antibody

anti-Breast Cancer 1 (BRCA1) (N-Term) antibody

Cat no: ABIN1545520

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Breast Cancer 1 (BRCA1) (N-Term) antibody: This is a rabbit polyclonal antibody against BRCA1. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN1545520
Reactivities: Human, Rat, Canine, Drosophila/Arthropod
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 672,403437
Concentration: 1 mg/mL
Antigen: BRCA1 (breast cancer 1, early onset) (BRCA1)
Clonality: Polyclonal
Sequence: MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCD HIFCKFCMLK
Molecular weight: 76 kDa
Entrez gene: 672,403437

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave