Home  >  Products  >  anti-Bromodomain Adjacent To Zinc Finger Domain, 1A (BAZ1A) (Middle Region) antibody
anti-Bromodomain Adjacent To Zinc Finger Domain, 1A (BAZ1A) (Middle Region) antibody

anti-Bromodomain Adjacent To Zinc Finger Domain, 1A (BAZ1A) (Middle Region) antibody

Cat no: ABIN486992

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Bromodomain Adjacent To Zinc Finger Domain, 1A (BAZ1A) (Middle Region) antibody: This is a rabbit polyclonal antibody against BAZ1A. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN486992
Reactivities: Human, Mouse, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 11177,480287,540621,217578
Concentration: 1 mg/mL
Antigen: BAZ1A
Clonality: Polyclonal
Sequence: SLPKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRS QQSTPKTTVS
Molecular weight: 179 kDa
Entrez gene: 11177,480287,540621,217578

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave