Home  >  Products  >  anti-BUD31 Homolog (S. Cerevisiae) (BUD31) (N-Term) antibody
anti-BUD31 Homolog (S. Cerevisiae) (BUD31) (N-Term) antibody

anti-BUD31 Homolog (S. Cerevisiae) (BUD31) (N-Term) antibody

Cat no: ABIN405158

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-BUD31 Homolog (S. Cerevisiae) (BUD31) (N-Term) antibody: This is a rabbit polyclonal antibody against BUD31. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405158
Reactivities: Human, Mouse, Rat, Bovine, C. elegans/Worm, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 8896,479743,533977,231889,89819
Concentration: 1 mg/mL
Antigen: BUD31
Clonality: Polyclonal
Sequence: PKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKR KVESLWPIFR
Molecular weight: 17 kDa
Entrez gene: 8896,479743,533977,231889,89819

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave