Home  >  Products  >  anti-C-Myc Binding Protein (MYCBP) (Middle Region) antibody
anti-C-Myc Binding Protein (MYCBP) (Middle Region) antibody

anti-C-Myc Binding Protein (MYCBP) (Middle Region) antibody

Cat no: ABIN182424

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-C-Myc Binding Protein (MYCBP) (Middle Region) antibody: This is a rabbit polyclonal antibody against MYCBP. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN182424
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 770496,26292,475323,539291,56309,100361133
Concentration: 1 mg/mL
Antigen: MYCBP
Clonality: Polyclonal
Sequence: AATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQY EPPQEEKRAE
Molecular weight: 12 kDa
Entrez gene: 770496,26292,475323,539291,56309,100361133

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave