Home  >  Products  >  anti-C-Type Lectin Domain Family 4, Member M (CLEC4M) (N-Term) antibody
anti-C-Type Lectin Domain Family 4, Member M (CLEC4M) (N-Term) antibody

anti-C-Type Lectin Domain Family 4, Member M (CLEC4M) (N-Term) antibody

Cat no: ABIN405467

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-C-Type Lectin Domain Family 4, Member M (CLEC4M) (N-Term) antibody: This is a rabbit polyclonal antibody against CLEC4M. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405467
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: Q9H2X3
Gene: 10332
Concentration: 1 mg/mL
Antigen: CLEC4M
Clonality: Polyclonal
Sequence: MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHK SSTGCLGHGA
Molecular weight: 30 kDa
Entrez gene: 10332

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave