Home  >  Products  >  anti-C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7) (Middle Region) antibody
anti-C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7) (Middle Region) antibody

anti-C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7) (Middle Region) antibody

Cat no: ABIN503344

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7) (Middle Region) antibody: This is a rabbit polyclonal antibody against C1QTNF7. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN503344
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 114905,609169,100233173,540131,100301536,109323,305423
Concentration: 1 mg/mL
Antigen: C1QTNF7
Clonality: Polyclonal
Sequence: SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPAT GKFICAFPGI
Molecular weight: 31 kDa
Entrez gene: 114905,609169,100233173,540131,100301536,109323,305423

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave