Home  >  Products  >  anti-Calcium and Integrin Binding Protein 3 (CIB3) (N-Term) antibody

anti-Calcium and Integrin Binding Protein 3 (CIB3) (N-Term) antibody

Cat no: ABIN406220


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Calcium and Integrin Binding Protein 3 (CIB3) (N-Term) antibody: This is a rabbit polyclonal antibody against CIB3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406220
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Drosophila/Arthropod, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 101101843,420151,117286,610270,539263,234421,685723
Concentration: 1 mg/mL
Antigen: CIB3
Clonality: Polyclonal
Sequence: QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRI AQVFSEDGDG
Molecular weight: 22 kDa
Entrez gene: 101101843,420151,117286,610270,539263,234421,685723

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave