Home  >  Products  >  anti-Calcium Channel, Voltage-Dependent, alpha 2/delta Subunit 1 (CACNA2D1) (Middle Region) antibody

anti-Calcium Channel, Voltage-Dependent, alpha 2/delta Subunit 1 (CACNA2D1) (Middle Region) antibody

Cat no: ABIN183113


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Calcium Channel, Voltage-Dependent, alpha 2/delta Subunit 1 (CACNA2D1) (Middle Region) antibody: This is a rabbit polyclonal antibody against CACNA2D1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183113
Reactivities: Human, Mouse, Rat, Canine, Chicken/Bird, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 768444,781,610342,397377,100009105,12293,25399
Concentration: 1 mg/mL
Antigen: CACNA2D1
Clonality: Polyclonal
Sequence: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRT LVKSQDERYI
Molecular weight: 120 kDa
Entrez gene: 768444,781,610342,397377,100009105,12293,25399

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave