Home  >  Products  >  anti-Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2) (Middle Region) antibody

anti-Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2) (Middle Region) antibody

Cat no: ABIN501435


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2) (Middle Region) antibody: This is a rabbit polyclonal antibody against CACNB2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501435
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 783,487113,327667,100009277,12296,116600
Concentration: 1 mg/mL
Antigen: CACNB2
Clonality: Polyclonal
Sequence: AYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGS QGDQRTDRSA
Molecular weight: 68 kDa
Entrez gene: 783,487113,327667,100009277,12296,116600

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave