Home  >  Products  >  anti-Calcium Channel, Voltage-Dependent, beta 3 Subunit (CACNB3) (C-Term) antibody

anti-Calcium Channel, Voltage-Dependent, beta 3 Subunit (CACNB3) (C-Term) antibody

Cat no: ABIN183116


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Calcium Channel, Voltage-Dependent, beta 3 Subunit (CACNB3) (C-Term) antibody: This is a rabbit polyclonal antibody against CACNB3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183116
Reactivities: Human, Mouse, Rat, Bovine, Canine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 784,486563,282160,100009402,12297,25297
Concentration: 1 mg/mL
Antigen: CACNB3
Clonality: Polyclonal
Sequence: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYA DAYQDLYQPH
Molecular weight: 53 kDa
Entrez gene: 784,486563,282160,100009402,12297,25297

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave