Home  >  Products  >  anti-Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1) (Middle Region) antibody
anti-Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1) (Middle Region) antibody

anti-Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1) (Middle Region) antibody

Cat no: ABIN310711

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1) (Middle Region) antibody: This is a rabbit polyclonal antibody against CPS1. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310711
Reactivities: Human, Mouse, Rat, Chicken/Bird, Drosophila/Arthropod, Xenopus/Amphibian
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 733340,428994,1373,227231,497840
Concentration: 1 mg/mL
Antigen: CPS1
Clonality: Polyclonal
Sequence: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSV EFDWCAVSSI
Molecular weight: 165 kDa
Entrez gene: 733340,428994,1373,227231,497840

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave