Home  >  Products  >  anti-Caspase 3, Apoptosis-Related Cysteine Peptidase (CASP3) (N-Term) antibody
anti-Caspase 3, Apoptosis-Related Cysteine Peptidase (CASP3) (N-Term) antibody

anti-Caspase 3, Apoptosis-Related Cysteine Peptidase (CASP3) (N-Term) antibody

Cat no: ABIN184137

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Caspase 3, Apoptosis-Related Cysteine Peptidase (CASP3) (N-Term) antibody: This is a rabbit polyclonal antibody against CASP3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN184137
Reactivities: Human, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 836,403567,397244,408016,100008840,25402
Concentration: 1 mg/mL
Antigen: CASP3
Clonality: Polyclonal
Sequence: MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMD YPEMGLCIII
Molecular weight: 32 kDa
Entrez gene: 836,403567,397244,408016,100008840,25402

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave