Home  >  Products  >  anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) (N-Term) antibody

anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) (N-Term) antibody

Cat no: ABIN310252


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-CD40 Molecule, TNF Receptor Superfamily Member 5 (CD40) (N-Term) antibody: This is a rabbit polyclonal antibody against CD40. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310252
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: P25942
Gene: 958
Concentration: 1 mg/mL
Antigen: CD40
Clonality: Polyclonal
Sequence: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWH CTSEACESCV
Molecular weight: 30 kDa
Entrez gene: 958

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave