Home  >  Products  >  anti-CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4) (N-Term) antibody
anti-CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4) (N-Term) antibody

anti-CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4) (N-Term) antibody

Cat no: ABIN406438

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4) (N-Term) antibody: This is a rabbit polyclonal antibody against CDC42EP4. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406438
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100037164,771509,23580,475907,540152,56699,303653
Concentration: 1 mg/mL
Antigen: CDC42EP4
Clonality: Polyclonal
Sequence: SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSAL FVKNAMSLPQ
Molecular weight: 38 kDa
Entrez gene: 100037164,771509,23580,475907,540152,56699,303653

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave