Home  >  Products  >  anti-Centrosomal Protein 170B (CEP170B) (N-Term) antibody
anti-Centrosomal Protein 170B (CEP170B) (N-Term) antibody

anti-Centrosomal Protein 170B (CEP170B) (N-Term) antibody

Cat no: ABIN503657

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Centrosomal Protein 170B (CEP170B) (N-Term) antibody: This is a rabbit polyclonal antibody against KIAA0284. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN503657
Reactivities: Human, Mouse, Rat, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 734708,283638,217882
Concentration: 1 mg/mL
Antigen: KIAA0284
Clonality: Polyclonal
Sequence: QLTKARKQEEDDSLSDAGTYTIETEAQDTEVEEARKMIDQ VFGVLESPEL
Molecular weight: 171 kDa
Entrez gene: 734708,283638,217882

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave