Home  >  Products  >  anti-Chaperonin Containing TCP1, Subunit 4 (Delta) (CCT4) (C-Term) antibody
anti-Chaperonin Containing TCP1, Subunit 4 (Delta) (CCT4) (C-Term) antibody

anti-Chaperonin Containing TCP1, Subunit 4 (Delta) (CCT4) (C-Term) antibody

Cat no: ABIN182964

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Chaperonin Containing TCP1, Subunit 4 (Delta) (CCT4) (C-Term) antibody: This is a rabbit polyclonal antibody against CCT4. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN182964
Reactivities: Human
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Accession: P50991
Gene: 10575
Concentration: 1 mg/mL
Antigen: CCT4
Clonality: Polyclonal
Sequence: AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAG INVRKGGISN
Molecular weight: 58 kDa
Entrez gene: 10575

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave