Home  >  Products  >  anti-Chemokine (C-X-C Motif) Ligand 14 (CXCL14) (Middle Region) antibody
anti-Chemokine (C-X-C Motif) Ligand 14 (CXCL14) (Middle Region) antibody

anti-Chemokine (C-X-C Motif) Ligand 14 (CXCL14) (Middle Region) antibody

Cat no: ABIN184186

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Chemokine (C-X-C Motif) Ligand 14 (CXCL14) (Middle Region) antibody: This is a rabbit polyclonal antibody against CXCL14. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN184186
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 9547,610078,494467,511771,57266,306748
Concentration: 1 mg/mL
Antigen: CXCL14
Clonality: Polyclonal
Sequence: HCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNA WNEKRRVYEE
Molecular weight: 13 kDa
Entrez gene: 9547,610078,494467,511771,57266,306748

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave