Home  >  Products  >  anti-Chromatin Licensing and DNA Replication Factor 1 (CDT1) (C-Term) antibody
anti-Chromatin Licensing and DNA Replication Factor 1 (CDT1) (C-Term) antibody

anti-Chromatin Licensing and DNA Replication Factor 1 (CDT1) (C-Term) antibody

Cat no: ABIN310811

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Chromatin Licensing and DNA Replication Factor 1 (CDT1) (C-Term) antibody: This is a rabbit polyclonal antibody against CDT1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310811
Reactivities: Human, Mouse, Rat, Bovine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 81620,519016,67177,292071
Concentration: 1 mg/mL
Antigen: CDT1
Clonality: Polyclonal
Sequence: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMT RCPEQEQRLQ
Molecular weight: 60 kDa
Entrez gene: 81620,519016,67177,292071

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave