Home  >  Products  >  anti-Chromobox Homolog 8 (CBX8) (N-Term) antibody
anti-Chromobox Homolog 8 (CBX8) (N-Term) antibody

anti-Chromobox Homolog 8 (CBX8) (N-Term) antibody

Cat no: ABIN501310

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Chromobox Homolog 8 (CBX8) (N-Term) antibody: This is a rabbit polyclonal antibody against CBX8. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501310
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100150672,496172,422084,57332,608591,506458,30951,303731
Concentration: 1 mg/mL
Antigen: CBX8
Clonality: Polyclonal
Sequence: KRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRS PQDLASTSRA
Molecular weight: 43 kDa
Entrez gene: 100150672,496172,422084,57332,608591,506458,30951,303731

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave