Home  >  Products  >  anti-Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L) (Middle Region) antibody

anti-Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L) (Middle Region) antibody

Cat no: ABIN183330


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L) (Middle Region) antibody: This is a rabbit polyclonal antibody against CHD1L. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183330
Reactivities: Human, Mouse, Rat, Bovine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 9557,524787,68058,310707
Concentration: 1 mg/mL
Antigen: CHD1L
Clonality: Polyclonal
Sequence: DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSF EQLVNLQKTL
Molecular weight: 45 kDa
Entrez gene: 9557,524787,68058,310707

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave