Home  >  Products  >  anti-Chromosome 10 Open Reading Frame 54 (C10orf54) (N-Term) antibody
anti-Chromosome 10 Open Reading Frame 54 (C10orf54) (N-Term) antibody

anti-Chromosome 10 Open Reading Frame 54 (C10orf54) (N-Term) antibody

Cat no: ABIN503059

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Chromosome 10 Open Reading Frame 54 (C10orf54) (N-Term) antibody: This is a rabbit polyclonal antibody against C10orf54. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN503059
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: Q9H7M9
Gene: 64115
Concentration: 1 mg/mL
Antigen: C10orf54
Clonality: Polyclonal
Sequence: TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTS HDLAQRHGLE
Molecular weight: 34 kDa
Entrez gene: 64115

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave