Home  >  Products  >  anti-Chromosome 16 Open Reading Frame 78 (C16orf78) (Middle Region) antibody

anti-Chromosome 16 Open Reading Frame 78 (C16orf78) (Middle Region) antibody

Cat no: ABIN406244


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Chromosome 16 Open Reading Frame 78 (C16orf78) (Middle Region) antibody: This is a rabbit polyclonal antibody against C16orf78. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406244
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: Q8WTQ4
Gene: 123970
Concentration: 1 mg/mL
Antigen: C16orf78
Clonality: Polyclonal
Sequence: GVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRP NPFRRQSIVL
Molecular weight: 34 kDa
Entrez gene: 123970

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave