Home  >  Products  >  anti-Chromosome 5 Open Reading Frame 4 (C5orf4) (N-Term) antibody
anti-Chromosome 5 Open Reading Frame 4 (C5orf4) (N-Term) antibody

anti-Chromosome 5 Open Reading Frame 4 (C5orf4) (N-Term) antibody

Cat no: ABIN310378

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Chromosome 5 Open Reading Frame 4 (C5orf4) (N-Term) antibody: This is a rabbit polyclonal antibody against C5orf4. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310378
Reactivities: Human, Bovine, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Accession: Q96IV6
Gene: 10826
Concentration: 1 mg/mL
Antigen: C5orf4
Clonality: Polyclonal
Sequence: MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVA FWNSVTWHLQ
Molecular weight: 21 kDa
Entrez gene: 10826

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave