Home  >  Products  >  anti-Chromosome 6 Open Reading Frame 134 (C6orf134) (Middle Region) antibody

anti-Chromosome 6 Open Reading Frame 134 (C6orf134) (Middle Region) antibody

Cat no: ABIN405492


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Chromosome 6 Open Reading Frame 134 (C6orf134) (Middle Region) antibody: This is a rabbit polyclonal antibody against C6orf134. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405492
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: Q5SQI0
Gene: 79969
Concentration: 1 mg/mL
Antigen: C6orf134
Clonality: Polyclonal
Sequence: DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKE RVEPHQLAID
Molecular weight: 36 kDa
Entrez gene: 79969

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave