Home  >  Products  >  anti-Complement C2 (N-Term) antibody
anti-Complement C2 (N-Term) antibody

anti-Complement C2 (N-Term) antibody

Cat no: ABIN310195

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Complement C2 (N-Term) antibody: This is a rabbit polyclonal antibody against C2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310195
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 717,12263,24231,474853,448981,515440,100608992,100173033,100059162,419574,100355553
Concentration: 1 mg/mL
Antigen: C2
Clonality: Polyclonal
Sequence: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKES LGRKIQIQRS
Molecular weight: 81 kDa
Entrez gene: 717,12263,24231,474853,448981,515440,100608992,100173033,100059162,419574,100355553

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave