Home  >  Products  >  anti-Core-Binding Factor, Runt Domain, alpha Subunit 2, Translocated To, 2 (Human) (CBFA2T2) (Middle Region) antibody

anti-Core-Binding Factor, Runt Domain, alpha Subunit 2, Translocated To, 2 (Human) (CBFA2T2) (Middle Region) antibody

Cat no: ABIN183517


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Core-Binding Factor, Runt Domain, alpha Subunit 2, Translocated To, 2 (Human) (CBFA2T2) (Middle Region) antibody: This is a rabbit polyclonal antibody against CBFA2T2H. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183517
Reactivities: Human, Mouse, Rat
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: O70374
Gene: 12396
Concentration: 1 mg/mL
Antigen: CBFA2T2H
Clonality: Polyclonal
Sequence: RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVS RQHSPGSTDS
Molecular weight: 65 kDa
Entrez gene: 12396

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave