Home  >  Products  >  anti-Cysteine and Glycine-Rich Protein 3 (CSRP3) (Middle Region) antibody
anti-Cysteine and Glycine-Rich Protein 3 (CSRP3) (Middle Region) antibody

anti-Cysteine and Glycine-Rich Protein 3 (CSRP3) (Middle Region) antibody

Cat no: ABIN182946

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Cysteine and Glycine-Rich Protein 3 (CSRP3) (Middle Region) antibody: This is a rabbit polyclonal antibody against CSRP3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN182946
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 8048,610946,100337687,540407,13009,117505
Concentration: 1 mg/mL
Antigen: CSRP3
Clonality: Polyclonal
Sequence: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKF GESEKCPRCG
Molecular weight: 21 kDa
Entrez gene: 8048,610946,100337687,540407,13009,117505

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave