Home  >  Products  >  anti-Cytochrome P450, Family 3, Subfamily A, Polypeptide 43 (CYP3A4) (Middle Region) antibody

anti-Cytochrome P450, Family 3, Subfamily A, Polypeptide 43 (CYP3A4) (Middle Region) antibody

Cat no: ABIN503070


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Cytochrome P450, Family 3, Subfamily A, Polypeptide 43 (CYP3A4) (Middle Region) antibody: This is a rabbit polyclonal antibody against CYP3A43. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN503070
Reactivities: Human, Bovine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: Q9HB55
Gene: 64816
Concentration: 1 mg/mL
Antigen: CYP3A43
Clonality: Polyclonal
Sequence: ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDL ELVAQSIIII
Molecular weight: 58 kDa
Entrez gene: 64816

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave