Home  >  Products  >  anti-Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2) (Middle Region) antibody

anti-Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2) (Middle Region) antibody

Cat no: ABIN184090


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2) (Middle Region) antibody: This is a rabbit polyclonal antibody against CPEB2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN184090
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Drosophila/Arthropod, Porcine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 100330483,422832,132864,488821,100462674,538880,231207,360949
Concentration: 1 mg/mL
Antigen: CPEB2
Clonality: Polyclonal
Sequence: DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDID KRVEVKPYVL
Molecular weight: 37 kDa
Entrez gene: 100330483,422832,132864,488821,100462674,538880,231207,360949

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave