Home  >  Products  >  anti-DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37) (N-Term) antibody
anti-DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37) (N-Term) antibody

anti-DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37) (N-Term) antibody

Cat no: ABIN501563

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37) (N-Term) antibody: This is a rabbit polyclonal antibody against DHX37. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501563
Reactivities: Human, Mouse, Rat, Canine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100049114,416813,57647,477442,208144,288647
Concentration: 1 mg/mL
Antigen: DHX37
Clonality: Polyclonal
Sequence: PLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEVQASEAEM RLFYTTSKLG
Molecular weight: 129 kDa
Entrez gene: 100049114,416813,57647,477442,208144,288647

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave