Home  >  Products  >  anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) (N-Term) antibody
anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) (N-Term) antibody

anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) (N-Term) antibody

Cat no: ABIN501562

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) (N-Term) antibody: This is a rabbit polyclonal antibody against DHX58. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501562
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 79132,607803,100524520,508378,80861,303538
Concentration: 1 mg/mL
Antigen: DHX58
Clonality: Polyclonal
Sequence: AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGR WTVTTLSGDM
Molecular weight: 76 kDa
Entrez gene: 79132,607803,100524520,508378,80861,303538

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave